PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A09G0645
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 295aa    MW: 33520.3 Da    PI: 6.6033
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A09G0645genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.5e-172370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l++++  +G+g+W++ a+  g++Rt+k+c++rw++yl
      Gh_A09G0645 23 RGPWTIEEDFKLINYISIHGKGRWNSLAHSAGLKRTGKSCRLRWLNYL 70
                     89********************************************97 PP

2Myb_DNA-binding50.64.4e-1676119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
      Gh_A09G0645  76 RGNITLEEQLLILQLHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 119
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.0491874IPR017930Myb domain
SuperFamilySSF466898.63E-3120117IPR009057Homeodomain-like
SMARTSM007175.2E-142272IPR001005SANT/Myb domain
PfamPF002494.0E-162370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-222477IPR009057Homeodomain-like
CDDcd001676.71E-112570No hitNo description
SMARTSM007172.6E-1475123IPR001005SANT/Myb domain
PROSITE profilePS5129418.35275125IPR017930Myb domain
PfamPF002497.3E-1576119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-2278124IPR009057Homeodomain-like
CDDcd001676.36E-796119No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MDVKARSSSG PNMVSTEEED LKRGPWTIEE DFKLINYISI HGKGRWNSLA HSAGLKRTGK  60
SCRLRWLNYL RPDVRRGNIT LEEQLLILQL HSRWGNRWSK IAQYLPGRTD NEIKNYWRTR  120
VQKHAKQLKC DVNSKKFKDT MRYLWMPRLV ERIQAATTTT DTASALAATT SNASIEQMLL  180
PNLSYYTLDN VSTAASSDSI GTQVSPISDS TDYYNGVLAN YNPNQDYFQA NHESLISPIG  240
NYCNNGDGMD FGLIELNHHW VGDGDGDGDG DGDGLHNLLN AEDFFFLQHQ FNFNM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-272011724120MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012484599.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE16e-87MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D2NNI90.0A0A0D2NNI9_G
STRINGPOPTR_0010s15970.11e-115(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.12e-82myb domain protein 108